Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Mfge8 Protein

This Rat Mfge8 Protein spans the amino acid sequence from region 23-427aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(MFGM) (Milk fat globule-EGF factor 8) (MFG-E8) (O-acetyl GD3 ganglioside synthase) (AGS) (SED1)

UniProt

P70490

Expression Region

23-427aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASGDFCDSSLCLNGGTCLMGQDNDIYCLCPEGFTGLVCNETEKGPCSPNPCFHDAKCLVTEDTQRGDIFTEYICQCPVGYSGIHCELGCSTKLGLEGGAIADSQISASSVYMGFMGLQRWGPELARLYRTGIVNAWTASSYDSKPWIQVDFLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRRFEFIQDESGTGDKEFMGNQDNNSLKINMFNPTLEAQYIRLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNNTIPDSQITASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQKKVTGIITQGARDFGHIQYVASYKVAHSDDGVQWTVYEEQGTSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPLSWHNRITLRLELLGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myod1 3'UTR Lenti-reporter-Luc Vector
31307086 1.0 µg

Myod1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human Carbonic Anhydrase XII (CA12) ELISA Kit
MBS2022841-01 24 Strip Well

Human Carbonic Anhydrase XII (CA12) ELISA Kit

Sign In for Pricing
View Details
Human Carbonic Anhydrase XII (CA12) ELISA Kit
MBS2022841-02 48 Well

Human Carbonic Anhydrase XII (CA12) ELISA Kit

Sign In for Pricing
View Details
Human Carbonic Anhydrase XII (CA12) ELISA Kit
MBS2022841-03 96 Well

Human Carbonic Anhydrase XII (CA12) ELISA Kit

Sign In for Pricing
View Details
Human Carbonic Anhydrase XII (CA12) ELISA Kit
MBS2022841-04 5x 96 Well

Human Carbonic Anhydrase XII (CA12) ELISA Kit

Sign In for Pricing
View Details
Human Carbonic Anhydrase XII (CA12) ELISA Kit
MBS2022841-05 10x 96 Well

Human Carbonic Anhydrase XII (CA12) ELISA Kit

Sign In for Pricing
View Details