Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cap Protein

This Cap Protein spans the amino acid sequence from region 1-233aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O56129

Expression Region

1-233aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Porcine circovirus 2 (PCV2)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPT, Phosphorylated (T205) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (HRP)
MBS6426016-01 0.1 mL

MAPT, Phosphorylated (T205) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (HRP)

Sign In for Pricing
View Details
MAPT, Phosphorylated (T205) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (HRP)
MBS6426016-02 5x 0.1 mL

MAPT, Phosphorylated (T205) (Tau Protein, Microtubule-associated Protein Tau, DDPAC, FLJ31424, FTDP-17, MAPTL, MGC138549, MSTD, MTBT1, MTBT2, PPND) (HRP)

Sign In for Pricing
View Details
OSTM1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-8506R-BF488 100 µL

OSTM1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Trim16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7250005 3x 1.0 µg

Trim16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ACAD10 discontinued
506448 100 µg

ACAD10 discontinued

Sign In for Pricing
View Details
Recombinant Mycobacterium Ulcerans MUL_0671 Protein (aa 1-163)
VAng-Yyj4108-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Ulcerans MUL_0671 Protein (aa 1-163)

Sign In for Pricing
View Details