Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cap Protein

This Cap Protein spans the amino acid sequence from region 1-233aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O56129

Expression Region

1-233aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Porcine circovirus 2 (PCV2)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anserini ASMA ELISA Kit
EAA0443 96 Tests

Anserini ASMA ELISA Kit

Sign In for Pricing
View Details
JIP3 (MAPK8IP3) (NM_001040439) Human Tagged ORF Clone
RG213840 10 µg

JIP3 (MAPK8IP3) (NM_001040439) Human Tagged ORF Clone

Sign In for Pricing
View Details
AMPK alpha-1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-41337R-BF680 100 µL

AMPK alpha-1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rat Pan2 Pre-designed siRNA Set A
SI210031A 1 Each

Rat Pan2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SKALP Polyclonal Antibody, Biotin Conjugated
bs-6531R-Biotin 100 µL

SKALP Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Human alpha1ACT (Alpha1 Antichymotrypsin) ELISA Kit
MBS2508934-01 24 Tests

Human alpha1ACT (Alpha1 Antichymotrypsin) ELISA Kit

Sign In for Pricing
View Details