Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cap Protein

This Cap Protein spans the amino acid sequence from region 1-233aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

O56129

Expression Region

1-233aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Porcine circovirus 2 (PCV2)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pan2 (NM_001252327) Mouse Tagged ORF Clone
MR231653 10 µg

Pan2 (NM_001252327) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RAB3GAP2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
38338111 3x 1.0 µg

RAB3GAP2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SDE2 Double Nickase Plasmid (h2)
sc-410355-NIC-2 20 µg

SDE2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Human Kinase Library III
HKIN-III 1 set

Human Kinase Library III

Sign In for Pricing
View Details
Dynlrb1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7114004 1.0 µg DNA

Dynlrb1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
CIRBP (Cold-inducible RNA-binding Protein, A18 hnRNP, Glycine-rich RNA-binding Protein CIRP, A18HNRNP, CIRP) (MaxLight 750) discontinued
125010-ML750 100 µL

CIRBP (Cold-inducible RNA-binding Protein, A18 hnRNP, Glycine-rich RNA-binding Protein CIRP, A18HNRNP, CIRP) (MaxLight 750) discontinued

Sign In for Pricing
View Details