Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSTN Protein

This MSTN Protein spans the amino acid sequence from region 267-375aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(GDF-8) (Myostatin)

UniProt

Q6UKZ8

Expression Region

267-375aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Staphylococcus aureus Monoclonal Antibody
VAnt-Wyb506 Each

Staphylococcus aureus Monoclonal Antibody

Sign In for Pricing
View Details
TNNI3 Antibody
13-057 100 µL

TNNI3 Antibody

Sign In for Pricing
View Details
APC anti-rat CD11b/c
GT06398 50 µg

APC anti-rat CD11b/c

Sign In for Pricing
View Details
Rabbit Monoclonal DC-LAMP Antibody Pair [HRP]
NBP2-79484-5Plates 5 Plates

Rabbit Monoclonal DC-LAMP Antibody Pair [HRP]

Sign In for Pricing
View Details
Synthetic Human Leutenizing Hormone Releasing Hormone
19301P-1 10 mg

Synthetic Human Leutenizing Hormone Releasing Hormone

Sign In for Pricing
View Details
NARS Antibody (Biotin)
orb25096-01 50 µg

NARS Antibody (Biotin)

Sign In for Pricing
View Details