CCL17 Protein (Biotin)
This CCL17 Protein (Biotin) spans the amino acid sequence from region 24-99aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(CC chemokine TARC) (Small-inducible cytokine A17) (Thymus and activation-regulated chemokine)
UniProt
Q95N01
Expression Region
24-99aa
Tag
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Source
E.coli
Origin
Canis lupus familiaris (Dog) (Canis familiaris)
Field of Research
Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
56.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
250159 100 µL
PKMYT1 (Protein Kinase, Membrane Associated Tyrosine/Threonine 1, DKFZp547K1610, FLJ20093, MYT1)
Sign In for Pricing
View Details 
CK-bio-10757-01 48 Tests
Human cardiac troponin I, cTn-I/TNNI3 ELISA Kit
Sign In for Pricing
View Details CK-bio-10757-02 96 Tests
Human cardiac troponin I, cTn-I/TNNI3 ELISA Kit
Sign In for Pricing
View Details CK-bio-10757-03 5x 96 Tests
Human cardiac troponin I, cTn-I/TNNI3 ELISA Kit
Sign In for Pricing
View Details CK-bio-10757-04 10x 96 Tests
Human cardiac troponin I, cTn-I/TNNI3 ELISA Kit
Sign In for Pricing
View Details 134743-AP 100 µL
TRIM33 (E3 Ubiquitin-protein Ligase TRIM33, Ectodermin Homolog, RET-fused Gene 7 Protein, Protein Rfg7, Transcription Intermediary Factor 1-gamma, TIF1-gamma, Tripartite Motif-containing Protein 33, KIAA1113, RFG7, TIF1G) (AP) discontinued
Sign In for Pricing
View Details