Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GPR132 Protein

This Human GPR132 Protein spans the amino acid sequence from region 311-380aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(G2 accumulation protein)

UniProt

Q9UNW8

Expression Region

311-380aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEESC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC class I Rabbit mAb
56137 50 µL

MHC class I Rabbit mAb

Sign In for Pricing
View Details
ITM2B, CT (ITM2B, BRI, BRI2, Integral membrane protein 2B, Immature BRI2, Protein E25B, Transmembrane protein BRI, BRI2, membrane form, Mature BRI2, BRI2 intracellular domain, BRI2C, soluble form, Bri23 peptide, ABri23, C-terminal peptide, P23 peptide) (PE) discontinued
037159-PE 200 µL

ITM2B, CT (ITM2B, BRI, BRI2, Integral membrane protein 2B, Immature BRI2, Protein E25B, Transmembrane protein BRI, BRI2, membrane form, Mature BRI2, BRI2 intracellular domain, BRI2C, soluble form, Bri23 peptide, ABri23, C-terminal peptide, P23 peptide) (PE) discontinued

Sign In for Pricing
View Details
Moesin (Membrane-organizing extension spike protein, Moesin/anaplastic lymphoma kinase fusion protein, MSN/ALK fusion) (BSA & Azide Free) (MaxLight 650)
168834-AF-ML650 100 µL

Moesin (Membrane-organizing extension spike protein, Moesin/anaplastic lymphoma kinase fusion protein, MSN/ALK fusion) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
Vitamin D Binding protein (GC) Human shRNA Plasmid Kit (Locus ID 2638)
TR312823 1 Kit

Vitamin D Binding protein (GC) Human shRNA Plasmid Kit (Locus ID 2638)

Sign In for Pricing
View Details
Retinoid X receptor alpha Rabbit Polyclonal Antibody (FITC)
orb16284 100 µL

Retinoid X receptor alpha Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
NBPF6 Rabbit pAb, BF700 conjugated
orb2881039 100 µL

NBPF6 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details