Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human herpesvirus 6B G-protein coupled receptor Protein

This Human herpesvirus 6B G-protein coupled receptor Protein spans the amino acid sequence from region 1-39aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9QJ51

Expression Region

1-39aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)

Field of Research

Epigenetics, GPCR, Neuroscience, Non-Animal, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTVIELSKLLHDEEFKDNASCTSTPTLKTARIIESAVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chloro- (2'-chloro) trityl Polystyrene
H10033.100G 100 g

Chloro- (2'-chloro) trityl Polystyrene

Sign In for Pricing
View Details
5,5-dimethyl-2- (4- (2-methylpropyl) phenyl) -1,3-thiazolidine-4-carboxylic acid
FD169826 500 mg

5,5-dimethyl-2- (4- (2-methylpropyl) phenyl) -1,3-thiazolidine-4-carboxylic acid

Sign In for Pricing
View Details
HCG2P2 AAV siRNA Pooled Vector
58591161 1.0 µg

HCG2P2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
TSHB Polyclonal Antibody
ABP60782-01 30 µL

TSHB Polyclonal Antibody

Sign In for Pricing
View Details
TSHB Polyclonal Antibody
ABP60782-02 100 µL

TSHB Polyclonal Antibody

Sign In for Pricing
View Details
TSHB Polyclonal Antibody
ABP60782-03 200 µL

TSHB Polyclonal Antibody

Sign In for Pricing
View Details