Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PYCARD Protein

This Human PYCARD Protein spans the amino acid sequence from region 1-93aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caspase recruitment domain-containing protein 5 PYD and CARD domain-containing protein Target of methylation-induced silencing 1

UniProt

Q9ULZ3

Expression Region

1-93aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC9 ORF Vector (Human) (pORF)
23137011 1.0 µg DNA

HDAC9 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PTEN Protein Vector (Rat) (pPB-C-His)
PV297042 500 ng

PTEN Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
LRMP Protein Vector (Human) (pPB-C-His)
PV054801 500 ng

LRMP Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti-CENP-E Antibody, Affinity Purified
A301-943A-T 10 µg

Rabbit anti-CENP-E Antibody, Affinity Purified

Sign In for Pricing
View Details
Recombinant Human 26S proteasome non-ATPase regulatory subunit 13 (PSMD13)
MBS1287348-01 0.02 mg (E-Coli)

Recombinant Human 26S proteasome non-ATPase regulatory subunit 13 (PSMD13)

Sign In for Pricing
View Details
Recombinant Human 26S proteasome non-ATPase regulatory subunit 13 (PSMD13)
MBS1287348-02 0.02 mg (Yeast)

Recombinant Human 26S proteasome non-ATPase regulatory subunit 13 (PSMD13)

Sign In for Pricing
View Details