Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PYCARD Protein

This Human PYCARD Protein spans the amino acid sequence from region 1-93aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caspase recruitment domain-containing protein 5 PYD and CARD domain-containing protein Target of methylation-induced silencing 1

UniProt

Q9ULZ3

Expression Region

1-93aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANXA6 siRNA (Human)
CRH0211-01 15 nmol

ANXA6 siRNA (Human)

Sign In for Pricing
View Details
ANXA6 siRNA (Human)
CRH0211-02 30 nmol

ANXA6 siRNA (Human)

Sign In for Pricing
View Details
IFN-gamma Polyclonal Antibody, Cy7 Conjugated
bs-41061R-Cy7 100 µL

IFN-gamma Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
ANAPC11 (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882) (HRP)
MBS6151198-01 0.1 mL

ANAPC11 (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882) (HRP)

Sign In for Pricing
View Details
ANAPC11 (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882) (HRP)
MBS6151198-02 5x 0.1 mL

ANAPC11 (Anaphase-promoting Complex Subunit 11, APC11, Cyclosome Subunit 11, Hepatocellular Carcinoma-associated RING Finger Protein, HSPC214, MGC882) (HRP)

Sign In for Pricing
View Details
Anti-Hu CD105 PE
MBS1801125-01 100 Tests

Anti-Hu CD105 PE

Sign In for Pricing
View Details