Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KLK12 Protein

This Human KLK12 Protein spans the amino acid sequence from region 18-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Kallikrein-like protein 5) (KLK-L5)

UniProt

Q9UKR0

Expression Region

18-248aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLK1
522292-01 100 µL

DLK1

Sign In for Pricing
View Details
DLK1
522292-02 200 µL

DLK1

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Probable intracellular septation protein A (yciB)
orb2919603-01 20 µg

Recombinant Escherichia coli O45:K1 Probable intracellular septation protein A (yciB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O45:K1 Probable intracellular septation protein A (yciB)
orb2919603-02 100 µg

Recombinant Escherichia coli O45:K1 Probable intracellular septation protein A (yciB)

Sign In for Pricing
View Details
Phospho-DAXX (Ser671) Polyclonal Antibody, PE Conjugated
bs-5293R-PE 100 µL

Phospho-DAXX (Ser671) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Human CEACAM-19 Alexa Fluor 488 Antibody (Clone 1042108)
FAB93971G-100UG 100 µg

Human CEACAM-19 Alexa Fluor 488 Antibody (Clone 1042108)

Sign In for Pricing
View Details