Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KLK12 Protein

This Human KLK12 Protein spans the amino acid sequence from region 18-248aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Kallikrein-like protein 5) (KLK-L5)

UniProt

Q9UKR0

Expression Region

18-248aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
abx252991 96 Tests

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

Sign In for Pricing
View Details
PerCP Anti-rabbit/ dog/ mouse/ human CD146 Antibody *P1H12*
114601S2-AAT 500 Tests

PerCP Anti-rabbit/ dog/ mouse/ human CD146 Antibody *P1H12*

Sign In for Pricing
View Details
Recombinant Rat MCP-3/CCL7
P6920-100μg 100 µg

Recombinant Rat MCP-3/CCL7

Sign In for Pricing
View Details
Tcf7l1 (NM_001107865) Rat Tagged Lenti ORF Clone
RR208696L3 10 µg

Tcf7l1 (NM_001107865) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HRP-conjugated Rabbit anti GFP-Tag mAb
AE114 50 µL

HRP-conjugated Rabbit anti GFP-Tag mAb

Sign In for Pricing
View Details
SLC35B1 Antibody (HRP)
orb25725-01 50 µg

SLC35B1 Antibody (HRP)

Sign In for Pricing
View Details