Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vpl1 Protein

This vpl1 Protein spans the amino acid sequence from region 31-361aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Versatile liquid phase peroxidase 1)

UniProt

Q9UR19

Expression Region

31-361aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pleurotus eryngii (Boletus of the steppes)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATCADGRTTANAACCVLFPILDDIQENLFDGAQCGEEVHESLRLTFHDAIGFSPTLGGGGADGSIIAFDTIETNFPANAGIDEIVSAQKPFVAKHNISAGDFIQFAGAVGVSNCPGGVRIPFFLGRPDAVAASPDHLVPEPFDSVDSILARMSDAGFSPVEVVWLLASHSIAAADKVDPSIPGTPFDSTPGVFDSQFFIETQLKGRLFPGTADNKGEAQSPLQGEIRLQSDHLLARDPQTACEWQSMVNNQPKIQNRFAATMSKMALLGQDKTKLIDCSDVIPTPPALVGAAHLPAGFSLSDVEQACAATPFPALTADPGPVTSVPPVPGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACH2 (NM_021813) Human Tagged ORF Clone Lentiviral Particle
RC214061L1V 200 µL

BACH2 (NM_021813) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SLFNL1 siRNA (Mouse)
CRN1491-01 15 nmol

SLFNL1 siRNA (Mouse)

Sign In for Pricing
View Details
SLFNL1 siRNA (Mouse)
CRN1491-02 30 nmol

SLFNL1 siRNA (Mouse)

Sign In for Pricing
View Details
TNFRSF21 Rabbit pAb
E2860266 100 µL

TNFRSF21 Rabbit pAb

Sign In for Pricing
View Details
Transcription Factor PU.1 (SPI1) Antibody
abx110272-01 20 µg

Transcription Factor PU.1 (SPI1) Antibody

Sign In for Pricing
View Details
Transcription Factor PU.1 (SPI1) Antibody
abx110272-02 50 µg

Transcription Factor PU.1 (SPI1) Antibody

Sign In for Pricing
View Details