Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GPRC5D Protein

This Human GPRC5D Protein spans the amino acid sequence from region 261-345aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9NZD1

Expression Region

261-345aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc25b Rabbit Polyclonal Antibody (Cy3)
orb2595394 100 µg

Cdc25b Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Mtap4 Protein Vector (Mouse) (pPB-C-His)
PV202602 500 ng

Mtap4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Vonafexor (EYP001)
C07371-5mg 5 mg

Vonafexor (EYP001)

Sign In for Pricing
View Details
YnfA Antibody
orb831612 2 mg

YnfA Antibody

Sign In for Pricing
View Details
Anti-TRAF2 Antibody
CQA2285-01 30 µL

Anti-TRAF2 Antibody

Sign In for Pricing
View Details
Anti-TRAF2 Antibody
CQA2285-02 50 μL

Anti-TRAF2 Antibody

Sign In for Pricing
View Details