Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PlyC Protein

This plyC Protein spans the amino acid sequence from region 21-420aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

B0XMA2

Expression Region

21-420aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVAFPGAEGFGANAIGGRNGQVYVVTNLNDSGTGSLRDAVSATDRIVVFAVGGVIKISDRIVVSKRVTILGQTAPGDGITVYGNGWSFSNADDAIVRYIRIRMGKGGSSGKDALGIAEGNRMIFDHVSVSWGRDETFSINGDASNITVQNSIIAQGLETHSCGGLMQTDGGVSLFRNLYIDNKTRNPKVKGVNEFTNNVVYNWGGGGGYIAGDSAGQSYANIIGNYFISGPSTSVTAFTRGNANFHGYVQNNYYDPDKDGQLDGFELGVSSSNYGGVAIMSSKYNYPAVAYTMSPAEAVTYVTKYAGASKVRDSVDTQLIAQVQSWGTEGGLISDEATMGGPGTLNGGTPAKDTDGDGIPDEAEKQLGTDPNTNDSMKLHSSGYTYLEVWANSLVPSTYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LOXL4 antibody
STJ115097 100 µl

Anti-LOXL4 antibody

Sign In for Pricing
View Details
SERF1 Rabbit Polyclonal Antibody (BF750)
orb2464323 100 µL

SERF1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Prss32 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3144903 1.0 µg DNA

Prss32 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CAMKK2 Antibody
E45M02357G-4 50 µL

CAMKK2 Antibody

Sign In for Pricing
View Details
FGFR2 (NM_001144919) Human 3' UTR Clone
SC204253 10 µg

FGFR2 (NM_001144919) Human 3' UTR Clone

Sign In for Pricing
View Details
6-Amino-7-fluoro-3,4-dihydroquinazolin-4-one
CKB82572-01 250 mg

6-Amino-7-fluoro-3,4-dihydroquinazolin-4-one

Sign In for Pricing
View Details