Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MrcA Protein (Biotin)

This mrcA Protein (Biotin) spans the amino acid sequence from region 229-529aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, PBP-1a Short name, PBP1a Including the following 2 domains, Penicillin-insensitive transglycosylase Alternative name (s), Peptidoglycan TGase Penicillin-sensitive transpeptidase Alternative name (s), DD-transpeptidase

UniProt

P02918

Expression Region

229-529aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

81.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLDEGYITQQQFDQTRTEAINANYHAPEIAFSAPYLSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDNNKITDTLKALPTYGPLLPAAVTSANPQQATAMLADGSTVALSMEGVRWARPYRSDTQQGPTPRKVTDVLQTGQQIWVRQVGDAWWLAQVPEVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGLTLASMLNDVPISRWDASAGSDWQPKNSPPQYAGPIRLRQGLGQSKNVVM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Troponin T, Cardiac (TnTc, Cardiac muscle troponin T, cTnT, TNNT2) (MaxLight 405) discontinued
T8665-22B1-ML405 100 µL

Troponin T, Cardiac (TnTc, Cardiac muscle troponin T, cTnT, TNNT2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
DDX3X Polyclonal Antibody
E55A02647 100 µg

DDX3X Polyclonal Antibody

Sign In for Pricing
View Details
Mouse pre-microRNA Expression Construct mir-484
MMIR-484-PA-1 Bacterial Streak

Mouse pre-microRNA Expression Construct mir-484

Sign In for Pricing
View Details
SH3YL1 CRISPRa sgRNA lentivector (set of three targets)(Human)
43689121 3x 1.0µg DNA

SH3YL1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ZKSCAN3 Protein Vector (Mouse) (pPM-C-His)
PV250809 500 ng

ZKSCAN3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cadherin, Neuronal (CDH2)
MBS2055710-01 0.1 mL

APC-Linked Polyclonal Antibody to Cadherin, Neuronal (CDH2)

Sign In for Pricing
View Details