Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BBOX1 Protein

This Human BBOX1 Protein spans the amino acid sequence from region 1-387aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Gamma-butyrobetaine hydroxylase) (Gamma-BBH) (Gamma-butyrobetaine,2-oxoglutarate dioxygenase)

UniProt

O75936

Expression Region

1-387aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-H (A-12) : m-IgG Fc BP-HRP Bundle
sc-539859 1 Kit

NF-H (A-12) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Human 5-Hydroxytryptamine Receptor 2B (HTR2B) ELISA Kit
RDR-HTR2B-Hu-96Tests 96 Tests

Human 5-Hydroxytryptamine Receptor 2B (HTR2B) ELISA Kit

Sign In for Pricing
View Details
Drop-out Mix Modified w/Succinic Acid and Thiamine w/o Aminobenzoic Acid, Asparagine, Glycine, Methionine and Yeast Nitrogen Base (DO, Dropout, Powder)
D9546-01 100 g

Drop-out Mix Modified w/Succinic Acid and Thiamine w/o Aminobenzoic Acid, Asparagine, Glycine, Methionine and Yeast Nitrogen Base (DO, Dropout, Powder)

Sign In for Pricing
View Details
Drop-out Mix Modified w/Succinic Acid and Thiamine w/o Aminobenzoic Acid, Asparagine, Glycine, Methionine and Yeast Nitrogen Base (DO, Dropout, Powder)
D9546-02 500 g

Drop-out Mix Modified w/Succinic Acid and Thiamine w/o Aminobenzoic Acid, Asparagine, Glycine, Methionine and Yeast Nitrogen Base (DO, Dropout, Powder)

Sign In for Pricing
View Details
Drop-out Mix Modified w/Succinic Acid and Thiamine w/o Aminobenzoic Acid, Asparagine, Glycine, Methionine and Yeast Nitrogen Base (DO, Dropout, Powder)
D9546-03 1 Kg

Drop-out Mix Modified w/Succinic Acid and Thiamine w/o Aminobenzoic Acid, Asparagine, Glycine, Methionine and Yeast Nitrogen Base (DO, Dropout, Powder)

Sign In for Pricing
View Details
Drop-out Mix Modified w/Succinic Acid and Thiamine w/o Aminobenzoic Acid, Asparagine, Glycine, Methionine and Yeast Nitrogen Base (DO, Dropout, Powder)
D9546-04 2.5 Kg

Drop-out Mix Modified w/Succinic Acid and Thiamine w/o Aminobenzoic Acid, Asparagine, Glycine, Methionine and Yeast Nitrogen Base (DO, Dropout, Powder)

Sign In for Pricing
View Details