Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eucheuma serra Lectin ESA-2 Protein

This Eucheuma serra Lectin ESA-2 Protein spans the amino acid sequence from region 1-268aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P84331

Expression Region

1-268aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Eucheuma serra (Marine red alga) (Sphaerococcus serra)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRYTVQNQWGGSSAPWNDAGLWILGSRGNQNVMAVDVNSSDGGANLNGTMTYSGEGPIGFKGARRGESNVYDVENQWGGSSAPWHAGGQFVIGSRSGQGVLAVNITSSDGGKTLTGTMTYEREGPIGFKGTQSGGDTYNVENQWGGSSAPWNKAGIWALGDRSGQAMIAMDVSSSDGGKTLEGTMQYKGEGPIGFRGKLSGANNYSVENQWGGSSAPWNAAGDWLIGDRHNQNITAVKVSSDNDGKNLDGTCTYEREGPIGFKGVATS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA2G4D (Cytosolic Phospholipase A2 delta, cPLA2-delta, Phospholipase A2 Group IVD) (PE)
131425-PE 100 µL

PLA2G4D (Cytosolic Phospholipase A2 delta, cPLA2-delta, Phospholipase A2 Group IVD) (PE)

Sign In for Pricing
View Details
Alexa Fluor® 488 anti-human CD8a
GT06893 100 Tests

Alexa Fluor® 488 anti-human CD8a

Sign In for Pricing
View Details
Norovirus Genogroup II, Recombinant, His-Tag
471188 1 mg

Norovirus Genogroup II, Recombinant, His-Tag

Sign In for Pricing
View Details
Solanezumab Biosimilar (Monoclonal, IgG1-kappa)
A135133 100 µL

Solanezumab Biosimilar (Monoclonal, IgG1-kappa)

Sign In for Pricing
View Details
ANAPC1 Protein Vector (Human) (pPB-C-His)
PV062097 500 ng

ANAPC1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
ERβ Polyclonal Conjugated Antibody
orb1618820 100 µL

ERβ Polyclonal Conjugated Antibody

Sign In for Pricing
View Details