Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HPCA Protein

This Human HPCA Protein spans the amino acid sequence from region 2-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Calcium-binding protein BDR-2)

UniProt

P84074

Expression Region

2-193aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human 5-LO (phospho Ser523) Polyclonal Antibody
PA89034HU-01 50 µg

Rabbit Anti-Human 5-LO (phospho Ser523) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human 5-LO (phospho Ser523) Polyclonal Antibody
PA89034HU-02 100 µg

Rabbit Anti-Human 5-LO (phospho Ser523) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human 5-LO (phospho Ser523) Polyclonal Antibody
PA89034HU-03 500 µg

Rabbit Anti-Human 5-LO (phospho Ser523) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human 5-LO (phospho Ser523) Polyclonal Antibody
PA89034HU-04 1 mg

Rabbit Anti-Human 5-LO (phospho Ser523) Polyclonal Antibody

Sign In for Pricing
View Details
Yap1 3'UTR GFP Stable Cell Line
TU172411 1.0 mL

Yap1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Mortality factor 4-like protein 2, MORF4L2 ELISA Kit
MBS9316291-01 48 Well

Mouse Mortality factor 4-like protein 2, MORF4L2 ELISA Kit

Sign In for Pricing
View Details