Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fndc5 Protein

This Mouse Fndc5 Protein spans the amino acid sequence from region 29-140aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Fibronectin type III repeat-containing protein 2) (Peroxisomal protein) (PeP)

UniProt

Q8K4Z2

Expression Region

29-140aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAP2 Protein Lysate
OCOA09946-20UG 20 µg

STAP2 Protein Lysate

Sign In for Pricing
View Details
GABAB R1 Polyclonal Antibody
40945-01 50 µL

GABAB R1 Polyclonal Antibody

Sign In for Pricing
View Details
GABAB R1 Polyclonal Antibody
40945-02 100 µL

GABAB R1 Polyclonal Antibody

Sign In for Pricing
View Details
SRP54b CRISPR Activation Plasmid (m)
sc-437071-ACT 20 µg

SRP54b CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
BCL7B Polyclonal Antibody, Cy5.5 Conjugated
bs-9298R-Cy5.5 100 µL

BCL7B Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Rat Cathepsin L ELISA Kit
MBS043212-01 48 Well

Rat Cathepsin L ELISA Kit

Sign In for Pricing
View Details