Phoneutria nigriventer Omega-ctenitoxin-Pn3a Protein
This Phoneutria nigriventer Omega-ctenitoxin-Pn3a Protein spans the amino acid sequence from region 40-115aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(Omega-CNTX-Pn3a) (Neurotoxin Tx3-4) (Omega-phonetoxin-2A) (Omega-phonetoxin-IIA) (Omega-Ptx-IIA) (PF3) (Phoneutriatoxin 3-4) (Pn3-4A)
UniProt
P81790
Expression Region
40-115aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)
Field of Research
Epigenetics, Neuroscience
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
15.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SCINVGDFCDGKKDDCQCCRDNAFCSCSVIFGYKTNCRCEVGTTATSYGICMAKHKCGRQTTCTKPCLSKRCKKNH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY419077 100 µg
PCPTP1 (PTPRR) (NM_002849) Human Over-expression Lysate
Sign In for Pricing
View Details 
TRC-A415855-50MG 50 mg
Androst-5-ene-3beta,17beta-diol 17-sulfate Sodium
Sign In for Pricing
View Details 
BNC401959-100 1x 100 µL
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
