Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL13 Protein

This IL13 Protein spans the amino acid sequence from region 34-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A2I2UTQ7

Expression Region

34-144aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPHSRRELKELIEELVNITQNQVSLCNGSMVWSVNLTTGMYCAALESLINVSDCTAIQRTQRMLKALCTQKPSAGQTASERSRDTKIEVIQLVKNLLNHLRRNFRHGNFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1B Antibody, FITC conjugated
CSB-PA011614YC01SH-01 50 µg

IL1B Antibody, FITC conjugated

Sign In for Pricing
View Details
IL1B Antibody, FITC conjugated
CSB-PA011614YC01SH-02 100 µg

IL1B Antibody, FITC conjugated

Sign In for Pricing
View Details
HSD11B1 Rabbit Polyclonal Antibody (BF405)
orb2426288 100 µL

HSD11B1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
CD1E siRNA (Human)
CRH0642-01 15 nmol

CD1E siRNA (Human)

Sign In for Pricing
View Details
CD1E siRNA (Human)
CRH0642-02 30 nmol

CD1E siRNA (Human)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Transglutaminase 2 (TGM2)
MBS2146730-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Transglutaminase 2 (TGM2)

Sign In for Pricing
View Details