Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ELOA3DP Protein

This Human ELOA3DP Protein spans the amino acid sequence from region 270-429aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A6NLF2

Expression Region

270-429aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LWDPSEAWMQANYDLLSAFEAMTSQANPEALSAPTLQEEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCLRVPRNNPDALGDVEGVPYSALEPVLEGWTPDQPYRTEKDNAALARETDELWRIHCLQDFKEEKPQEHESWRELYLRLRDAREQRLRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tex21 3'UTR Luciferase Stable Cell Line
TU120386 1.0 mL

Tex21 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Non Swiss Albino Serum
IMSNSASER1000ML 1 Each

Mouse Non Swiss Albino Serum

Sign In for Pricing
View Details
CD47 Polyclonal Antibody
MBS2539161-01 0.06 mL

CD47 Polyclonal Antibody

Sign In for Pricing
View Details
CD47 Polyclonal Antibody
MBS2539161-02 0.12 mL

CD47 Polyclonal Antibody

Sign In for Pricing
View Details
CD47 Polyclonal Antibody
MBS2539161-03 0.2 mL

CD47 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human HDAC8 Protein, N-His
orb2834904-01 20 µg

Recombinant Human HDAC8 Protein, N-His

Sign In for Pricing
View Details