Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Raphanus sativus Late embryogenesis abundant Protein

This Raphanus sativus Late embryogenesis abundant Protein spans the amino acid sequence from region 1-48aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Protein LEA)

UniProt

P21298

Expression Region

1-48aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Raphanus sativus (Radish) (Raphanus raphanistrum var. sativus)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADLKDERGNPIHLTDAYGNPVQLSDEFGNPMHITGVASSAPQYKDSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cluster Of Differentiation 229 (CD229) Magnetic Fluorescence Assay Kit
MBS2157676-01 96 Tests

Cluster Of Differentiation 229 (CD229) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cluster Of Differentiation 229 (CD229) Magnetic Fluorescence Assay Kit
MBS2157676-02 5x 96 Tests

Cluster Of Differentiation 229 (CD229) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cluster Of Differentiation 229 (CD229) Magnetic Fluorescence Assay Kit
MBS2157676-03 10x 96 Tests

Cluster Of Differentiation 229 (CD229) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Rabbit Polyclonal TTBK1 Antibody [Alexa Fluor 532]
NBP3-06356AF532 0.1 mL

Rabbit Polyclonal TTBK1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
5-Lipoxygenase (5-LO) Monoclonal Antibody
CAU36050-01 100 µL

5-Lipoxygenase (5-LO) Monoclonal Antibody

Sign In for Pricing
View Details
5-Lipoxygenase (5-LO) Monoclonal Antibody
CAU36050-02 200 µL

5-Lipoxygenase (5-LO) Monoclonal Antibody

Sign In for Pricing
View Details