Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TARDBP Protein

This Human TARDBP Protein spans the amino acid sequence from region 25-181aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, TDP-43

UniProt

Q13148

Expression Region

25-181aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SMARCB1 Antibody
RC-5108-01 50 μL

Recombinant SMARCB1 Antibody

Sign In for Pricing
View Details
Recombinant SMARCB1 Antibody
RC-5108-02 100 µL

Recombinant SMARCB1 Antibody

Sign In for Pricing
View Details
Recombinant SMARCB1 Antibody
RC-5108-03 1 mL

Recombinant SMARCB1 Antibody

Sign In for Pricing
View Details
Proteasome beta 1 (PSMB1) (NM_002793) Human Over-expression Lysate
LC419103 20 µg

Proteasome beta 1 (PSMB1) (NM_002793) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF259 (ZPR1) Rabbit Polyclonal Antibody
TA361841 100 µL

ZNF259 (ZPR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S100B (4C4.9), CF640R conjugate, 0.1mg/mL
BNC400143-100 1x 100 µL

S100B (4C4.9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details