Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CT83 Protein

This Human CT83 Protein spans the amino acid sequence from region 22-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 83

UniProt

Q5H943

Expression Region

22-113aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish SHHA Antibody Picoband® Biotin Conjugated
AZQ92008-Biotin 100 µg/Vial

Anti-Zebrafish SHHA Antibody Picoband® Biotin Conjugated

Sign In for Pricing
View Details
1- ({[ (9H-Fluoren-9-yl) methoxy]carbonyl} (methyl) amino) cyclohexane-1-carboxylic acid
XSC37742-01 100 mg

1- ({[ (9H-Fluoren-9-yl) methoxy]carbonyl} (methyl) amino) cyclohexane-1-carboxylic acid

Sign In for Pricing
View Details
1- ({[ (9H-Fluoren-9-yl) methoxy]carbonyl} (methyl) amino) cyclohexane-1-carboxylic acid
XSC37742-02 1 g

1- ({[ (9H-Fluoren-9-yl) methoxy]carbonyl} (methyl) amino) cyclohexane-1-carboxylic acid

Sign In for Pricing
View Details
MTMR12 Antibody Blocking Peptide
orb1509709 500 µg

MTMR12 Antibody Blocking Peptide

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius Tryptophan synthase beta chain (trpB)
MBS1319146-01 0.02 mg (E-Coli)

Recombinant Sodalis glossinidius Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius Tryptophan synthase beta chain (trpB)
MBS1319146-02 0.02 mg (Yeast)

Recombinant Sodalis glossinidius Tryptophan synthase beta chain (trpB)

Sign In for Pricing
View Details