Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mog Protein

This Mouse Mog Protein spans the amino acid sequence from region 29-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q61885

Expression Region

29-156aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DLL1 Protein, C-Fc
EHA15302 100 μg

Recombinant Human DLL1 Protein, C-Fc

Sign In for Pricing
View Details
LINC00453 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV731753 1.0 µg DNA

LINC00453 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Pyrroline-5-carboxylate reductase 1, mitochondrial
AP86512 1 mg

Pyrroline-5-carboxylate reductase 1, mitochondrial

Sign In for Pricing
View Details
AFF2 Protein Vector (Human) (pPM-C-HA)
PV061411 500 ng

AFF2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
5-Azaindole 99+%
233902-01 1 g

5-Azaindole 99+%

Sign In for Pricing
View Details
5-Azaindole 99+%
233902-02 5 g

5-Azaindole 99+%

Sign In for Pricing
View Details