Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mog Protein

This Mouse Mog Protein spans the amino acid sequence from region 29-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q61885

Expression Region

29-156aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLASP2 Rabbit Polyclonal Antibody
TA374832 100 µL

CLASP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human FBXO16 knockdown cell line
ABC-KD5398 1 Vial

Human FBXO16 knockdown cell line

Sign In for Pricing
View Details
Clomipramine
C03449-25mg 25 mg

Clomipramine

Sign In for Pricing
View Details
Mouse Monoclonal Lysozyme Antibody (LYZ/3944) [FITC]
NBP3-14115F 0.1 mL

Mouse Monoclonal Lysozyme Antibody (LYZ/3944) [FITC]

Sign In for Pricing
View Details
Agtpbp1 (NM_001284218) Mouse Untagged Clone
MC228936 10 µg

Agtpbp1 (NM_001284218) Mouse Untagged Clone

Sign In for Pricing
View Details
Notch1 Rabbit Polyclonal Antibody (APC-Cy7)
orb1586849 100 µL

Notch1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details