Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mog Protein

This Mouse Mog Protein spans the amino acid sequence from region 29-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q61885

Expression Region

29-156aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human FABP3/HFABP Monoclonal Antibody (1A341)
HY481025-01 50 µg

Anti-Human FABP3/HFABP Monoclonal Antibody (1A341)

Sign In for Pricing
View Details
Anti-Human FABP3/HFABP Monoclonal Antibody (1A341)
HY481025-02 100 µg

Anti-Human FABP3/HFABP Monoclonal Antibody (1A341)

Sign In for Pricing
View Details
Fish Palmitoyl-Protein Thioesterase 1 (PPT1) ELISA Kit
MBS9364418 Inquire

Fish Palmitoyl-Protein Thioesterase 1 (PPT1) ELISA Kit

Sign In for Pricing
View Details
Rat Apolipoprotein B (APOB) ELISA Kit
RD-APOB-Ra-96Tests 96 Tests

Rat Apolipoprotein B (APOB) ELISA Kit

Sign In for Pricing
View Details
ZNF485 Rabbit Polyclonal Antibody
orb577323 100 µL

ZNF485 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-tert-Butoxybenzoic acid
OR470339-01 100 mg

3-tert-Butoxybenzoic acid

Sign In for Pricing
View Details