Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP4 Protein

This Human BMP4 Protein spans the amino acid sequence from region 293-408aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone morphogenetic protein 2B , BMP-2B

UniProt

P12644

Expression Region

293-408aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Brain Pituitary Membrane Tissue Lysate (Adult Membrane Normal) - (Dry Ice)
NB820-60579 0.1 mg

Human Brain Pituitary Membrane Tissue Lysate (Adult Membrane Normal) - (Dry Ice)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS604910 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
AZD8055
TRC-A808130-10MG 10 mg

AZD8055

Sign In for Pricing
View Details
San Miguel sea lion viral disease RT PCR kit
RTq-V276-100R 100T

San Miguel sea lion viral disease RT PCR kit

Sign In for Pricing
View Details
2-Nitrophenyl-beta-D-galactopyranoside 98%
GPC6677-2X 250 g

2-Nitrophenyl-beta-D-galactopyranoside 98%

Sign In for Pricing
View Details
Cyclin-dependent-like kinase 5
orb1643495-01 50 µg

Cyclin-dependent-like kinase 5

Sign In for Pricing
View Details