Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DusB Protein

This dusB Protein spans the amino acid sequence from region 1-321aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0ABT6

Expression Region

1-321aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMGAGLTVSEMMSSNPQVWESDKSRLRMVHIDEPGIRTVQIAGSDPKEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNAVDVPVTLKIRTGWAPEHRNCEEIAQLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVSIPVIANGDITDPLKARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLCAHVRELHDFYGPAKGYRIARKHVSWYLQEHAPNDQFRRTFNAIEDASEQLEALEAYFENFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Primary And Secondary Coils
1070860 1 Each

Primary And Secondary Coils

Sign In for Pricing
View Details
Paralemmin 1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2538493 100 µL

Paralemmin 1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Anti-PPP2R5E Rabbit Monoclonal Antibody
M07588-1 100 µL/Vial

Anti-PPP2R5E Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Forskolin
TRC-F701800-25MG 25 mg

Forskolin

Sign In for Pricing
View Details
AL082D06 50mg
A12194-50 50 mg

AL082D06 50mg

Sign In for Pricing
View Details
anti-GTPase Hras
YF-PA12448 50 ul

anti-GTPase Hras

Sign In for Pricing
View Details