Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DusB Protein

This dusB Protein spans the amino acid sequence from region 1-321aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0ABT6

Expression Region

1-321aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMGAGLTVSEMMSSNPQVWESDKSRLRMVHIDEPGIRTVQIAGSDPKEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDVVKSILTEVVNAVDVPVTLKIRTGWAPEHRNCEEIAQLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVSIPVIANGDITDPLKARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLCAHVRELHDFYGPAKGYRIARKHVSWYLQEHAPNDQFRRTFNAIEDASEQLEALEAYFENFA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jph1 ORF Vector (Rat) (pORF)
25257016 1.0 µg DNA

Jph1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Human Interleukin-1 receptor accessory protein (IL1RAP), partial (Active)
CSB-MP878844HU-01 100 µg

Recombinant Human Interleukin-1 receptor accessory protein (IL1RAP), partial (Active)

Sign In for Pricing
View Details
Recombinant Human Interleukin-1 receptor accessory protein (IL1RAP), partial (Active)
CSB-MP878844HU-02 1 mg

Recombinant Human Interleukin-1 receptor accessory protein (IL1RAP), partial (Active)

Sign In for Pricing
View Details
SCARB1 (NM_005505) Human Recombinant Protein
TP310264L 1 mg

SCARB1 (NM_005505) Human Recombinant Protein

Sign In for Pricing
View Details
Transient Receptor Potential Cation Channel Subfamily C Member 1 (TRPC1) Antibody (FITC)
abx337677-01 20 µg

Transient Receptor Potential Cation Channel Subfamily C Member 1 (TRPC1) Antibody (FITC)

Sign In for Pricing
View Details
Transient Receptor Potential Cation Channel Subfamily C Member 1 (TRPC1) Antibody (FITC)
abx337677-02 50 µg

Transient Receptor Potential Cation Channel Subfamily C Member 1 (TRPC1) Antibody (FITC)

Sign In for Pricing
View Details