Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gossypium tomentosum Uncharacterized Protein

This Gossypium tomentosum Uncharacterized Protein spans the amino acid sequence from region 1-333aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A5D2MNQ7

Expression Region

1-333aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Gossypium tomentosum (Hawaiian cotton) (Gossypium sandvicense)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMLEETRQLNPTVLVPPWPYLGDDLAAENNFSDNGNPFYLQEALAALQCYLPSDEPGFESDSEISGLYNPGSPVDAYSCDHFRMFEFKVRRCGRGRSHDWTECPYAHPGEKARRRDPRKFHYSGMACSDFKKGNCRKGDSCEFAHGVFECWLHPARYRTLPCKDGSGCRRRVCFFAHTPDQLRVINFADSFDSSPPCTKAMSFSGSPPAECSPSVSPIAQPPTINTMVASLRNLRLGKVKSLPSSGFGSPKGSMIRPSLSSLPSTPTRNLTRPGIGYLDFECGEEFVMERVESGKHLRSKIFEKLSQANSLERVYSGLVSGGPDVDWVSDLVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PCNA Rabbit Monoclonal Antibody
M00125-5-200μl 200 µL

Anti-PCNA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 660
MBS4517271-01 0.1 mL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 660

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 660
MBS4517271-02 0.5 mL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 660

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 660
MBS4517271-03 1 mL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 660

Sign In for Pricing
View Details
Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 660
MBS4517271-04 5x 1 mL

Rabbit Anti-Human IgG+IgM+IgA - Alexa Fluor 660

Sign In for Pricing
View Details
Anti-SRPX Rabbit pAb
GB113423 100 μL

Anti-SRPX Rabbit pAb

Sign In for Pricing
View Details