Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BamA Protein

This BamA Protein spans the amino acid sequence from region 21-810aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

C4ZRR9

Expression Region

21-810aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli (strain K12 / MC4100 / BW2952)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

95.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human VEGF-121 Isoform Protein, Untagged, E.coli-2ug
QP5207-2ug 2ug

Recombinant Human VEGF-121 Isoform Protein, Untagged, E.coli-2ug

Sign In for Pricing
View Details
Rabbit anti-FHR3 Antibody
MBS4505213-01 0.05 mL

Rabbit anti-FHR3 Antibody

Sign In for Pricing
View Details
Rabbit anti-FHR3 Antibody
MBS4505213-02 0.1 mL

Rabbit anti-FHR3 Antibody

Sign In for Pricing
View Details
Rabbit anti-FHR3 Antibody
MBS4505213-03 5x 0.1 mL

Rabbit anti-FHR3 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal anti-human Ang1
hAP-0019 50 µg

Mouse Monoclonal anti-human Ang1

Sign In for Pricing
View Details
Lentiviral human YTHDF1 sgRNA gene knockout kit - Lentiviral human YTHDF1 sgRNA gene knockout kit (100)
GTR15358609 1 Vial

Lentiviral human YTHDF1 sgRNA gene knockout kit - Lentiviral human YTHDF1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details