Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DAZL Protein

This Human DAZL Protein spans the amino acid sequence from region 130-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DAZ homolog) (DAZ-like autosomal) (Deleted in azoospermia-like 1) (SPGY-like-autosomal)

UniProt

Q92904

Expression Region

130-250aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal V5-Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEFV Rabbit pAb, Pacific Blue conjugated
orb2857309 100 µL

MEFV Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
ATP4B Antibody, mAb, Rabbit
A04923-50 50 µL

ATP4B Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Mn (III) Protoporphyrin IX Chloride
T83663-01 10 mg

Mn (III) Protoporphyrin IX Chloride

Sign In for Pricing
View Details
Mn (III) Protoporphyrin IX Chloride
T83663-02 25 mg

Mn (III) Protoporphyrin IX Chloride

Sign In for Pricing
View Details
Mn (III) Protoporphyrin IX Chloride
T83663-03 5 mg

Mn (III) Protoporphyrin IX Chloride

Sign In for Pricing
View Details
C1orf65 (CCDC185) Human Over-expression Lysate
orb1353458 100 µg

C1orf65 (CCDC185) Human Over-expression Lysate

Sign In for Pricing
View Details