Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DPYSL4 Protein

This Human DPYSL4 Protein spans the amino acid sequence from region 280-560aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DRP-4) (Collapsin response mediator protein 3) (CRMP-3) (UNC33-like phosphoprotein 4) (ULIP-4)

UniProt

O14531

Expression Region

280-560aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal V5-Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLAEIHGVPRGVYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQKIMA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab 3/16 (G-1) Alexa Fluor® 546
sc-271044 AF546 200 µg/mL

Rab 3/16 (G-1) Alexa Fluor® 546

Sign In for Pricing
View Details
HER2 (Phospho-Tyr1112) Rabbit pAb
MBS8553995-01 0.1 mL

HER2 (Phospho-Tyr1112) Rabbit pAb

Sign In for Pricing
View Details
HER2 (Phospho-Tyr1112) Rabbit pAb
MBS8553995-02 0.1 mL (AF405L)

HER2 (Phospho-Tyr1112) Rabbit pAb

Sign In for Pricing
View Details
HER2 (Phospho-Tyr1112) Rabbit pAb
MBS8553995-03 0.1 mL (AF405S)

HER2 (Phospho-Tyr1112) Rabbit pAb

Sign In for Pricing
View Details
HER2 (Phospho-Tyr1112) Rabbit pAb
MBS8553995-04 0.1 mL (AF610)

HER2 (Phospho-Tyr1112) Rabbit pAb

Sign In for Pricing
View Details
HER2 (Phospho-Tyr1112) Rabbit pAb
MBS8553995-05 0.1 mL (AF635)

HER2 (Phospho-Tyr1112) Rabbit pAb

Sign In for Pricing
View Details