Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MMP8 Protein

This Human MMP8 Protein spans the amino acid sequence from region 101-467aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Matrix metalloproteinase-8) (MMP-8) (PMNL collagenase) (PMNL-CL)

UniProt

P22894

Expression Region

101-467aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LTPGNPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAVFQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Zinc Finger SWIM Domain-Containing Protein 6 (ZSWIM6) ELISA Kit
MBS9946047 Inquire

Goat Zinc Finger SWIM Domain-Containing Protein 6 (ZSWIM6) ELISA Kit

Sign In for Pricing
View Details
IRF3 antibody - C-terminal region
MBS3200693-01 0.1 mL

IRF3 antibody - C-terminal region

Sign In for Pricing
View Details
IRF3 antibody - C-terminal region
MBS3200693-02 5x 0.1 mL

IRF3 antibody - C-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal CD40/TNFRSF5 Antibody (CL1673)
NBP2-34488 0.1 mL

Mouse Monoclonal CD40/TNFRSF5 Antibody (CL1673)

Sign In for Pricing
View Details
Cyp2c69 siRNA Oligos set (Mouse)
17390174 3x 5 nmol

Cyp2c69 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
GJA4 Antibody
MBS7119401-01 0.05 mg

GJA4 Antibody

Sign In for Pricing
View Details