Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Feline coronavirus Non-structural protein 7a Protein

This Feline coronavirus Non-structural protein 7a Protein spans the amino acid sequence from region 44-75aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ns7a) (11 kDa protein) (Accessory protein 7a)

UniProt

P19742

Expression Region

44-75aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Feline coronavirus (strain FIPV WSU-79/1146) (FCoV)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPDSSLRVNCLQLLKPDCLDFNILHKVLAETR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE4B (Ubiquitin Conjugation Factor E4 B, E4, UFD2, HDNB1, UBOX3, UFD2A)
339032-01 50 µg

UBE4B (Ubiquitin Conjugation Factor E4 B, E4, UFD2, HDNB1, UBOX3, UFD2A)

Sign In for Pricing
View Details
UBE4B (Ubiquitin Conjugation Factor E4 B, E4, UFD2, HDNB1, UBOX3, UFD2A)
339032-02 100 µg

UBE4B (Ubiquitin Conjugation Factor E4 B, E4, UFD2, HDNB1, UBOX3, UFD2A)

Sign In for Pricing
View Details
IGLL5 (NM_001178126) Human Tagged ORF Clone Lentiviral Particle
RC229701L3V 200 µL

IGLL5 (NM_001178126) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CCKBR Antibody
CSB-PA094644-01 50 μL

CCKBR Antibody

Sign In for Pricing
View Details
CCKBR Antibody
CSB-PA094644-02 100 µL

CCKBR Antibody

Sign In for Pricing
View Details
Fndc3b 3'UTR GFP Stable Cell Line
TU254713 1.0 mL

Fndc3b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details