Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cyld Protein

This Mouse Cyld Protein spans the amino acid sequence from region 579-952aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Deubiquitinating enzyme CYLD) (Ubiquitin thioesterase CYLD) (Ubiquitin-specific-processing protease CYLD)

UniProt

Q80TQ2

Expression Region

579-952aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVLLRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ARFIP2 shRNA (UAS) - Lentiviral human ARFIP2 shRNA (UAS) (100)
GTR15343737 1 Vial

Lentiviral human ARFIP2 shRNA (UAS) - Lentiviral human ARFIP2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Monkey Valyl-tRNA Synthetase (VARS) ELISA Kit
MBS9389465-01 48 Well

Monkey Valyl-tRNA Synthetase (VARS) ELISA Kit

Sign In for Pricing
View Details
Monkey Valyl-tRNA Synthetase (VARS) ELISA Kit
MBS9389465-02 96 Well

Monkey Valyl-tRNA Synthetase (VARS) ELISA Kit

Sign In for Pricing
View Details
Monkey Valyl-tRNA Synthetase (VARS) ELISA Kit
MBS9389465-03 5x 96 Well

Monkey Valyl-tRNA Synthetase (VARS) ELISA Kit

Sign In for Pricing
View Details
Monkey Valyl-tRNA Synthetase (VARS) ELISA Kit
MBS9389465-04 10x 96 Well

Monkey Valyl-tRNA Synthetase (VARS) ELISA Kit

Sign In for Pricing
View Details
TMEM126A (Transmembrane protein 126A) BioAssayTM ELISA Kit (Human) discontinued
359322-01 48 Tests

TMEM126A (Transmembrane protein 126A) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details