Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLA2G10 Protein

This Human PLA2G10 Protein spans the amino acid sequence from region 43-165aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Group X secretory phospholipase A2) (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10)

UniProt

O15496

Expression Region

43-165aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Staphylococcus aureus Exfoliative Toxin A (ETA) (PE) discontinued
S7965-45-PE 100 µL

Staphylococcus aureus Exfoliative Toxin A (ETA) (PE) discontinued

Sign In for Pricing
View Details
EGLN1 Antibody
6151-100 100 µg

EGLN1 Antibody

Sign In for Pricing
View Details
RALYL Protein Vector (Mouse) (pPM-C-HA)
PV222232 500 ng

RALYL Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Ostn 3'UTR Luciferase Stable Cell Line
TU215682 1.0 mL

Ostn 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Anti-Chicken IgG (H&L) - APC
MBS8326078-01 0.1 mL

Rabbit Anti-Chicken IgG (H&L) - APC

Sign In for Pricing
View Details
Rabbit Anti-Chicken IgG (H&L) - APC
MBS8326078-02 0.5 mL

Rabbit Anti-Chicken IgG (H&L) - APC

Sign In for Pricing
View Details