Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLU Protein

This CLU Protein spans the amino acid sequence from region 1-191aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Sulfated glycoprotein 2) (SGP-2) (Fragment)

UniProt

P14683

Expression Region

1-191aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mesocricetus auratus (Golden hamster)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NRRPHFLYPKSRLIRSLLPPPHYGPLSFHDMFQPFLEMIHQAQQAMDVQFHSPAFQFPDMDLLREGEDDRAVCKEIRHNSTGCLKMKGQCEKCQEILSVDCSANNPAQAHLRQELNDSLQVAERLTQRYNELLHSLQTKMLNTSSLLEQLNEQFNWVSQLANLTQGEDQYYLRVSTVTTHSSDSEVPSRVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human MMP1 Protein, N-MBP & C-His (HEK293)
orb2328687-01 20 µg

Recombinant human MMP1 Protein, N-MBP & C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human MMP1 Protein, N-MBP & C-His (HEK293)
orb2328687-02 50 µg

Recombinant human MMP1 Protein, N-MBP & C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human MMP1 Protein, N-MBP & C-His (HEK293)
orb2328687-03 100 µg

Recombinant human MMP1 Protein, N-MBP & C-His (HEK293)

Sign In for Pricing
View Details
GADL1 Rabbit Polyclonal Antibody (HRP)
orb478600 100 µL

GADL1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
GLP2R Antibody (Center)
orb33091-01 50 µL

GLP2R Antibody (Center)

Sign In for Pricing
View Details
GLP2R Antibody (Center)
orb33091-02 100 µL

GLP2R Antibody (Center)

Sign In for Pricing
View Details