Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gag Protein

This gag Protein spans the amino acid sequence from region 240-476aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0C776

Expression Region

240-476aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Avian leukosis virus RSA (RSV-SRA) (Rous sarcoma virus (strain Schmidt-Ruppin A) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLDRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADITQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRAAPSTLTTPGEIIKYVLDRQKIAPLTDQGIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR582 Rat qPCR Primer Pair (MI0012595)
RP300343 200 Reactions

MIR582 Rat qPCR Primer Pair (MI0012595)

Sign In for Pricing
View Details
Rapsyn (m) -PR
sc-42207-PR 10 µM - 20 µL

Rapsyn (m) -PR

Sign In for Pricing
View Details
CCDC61 Rabbit pAb, PerCP-Cy7 conjugated
orb2858886 100 µL

CCDC61 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
SHP-2 (Ab-580) Antibody
MBS856919-01 0.05 mg

SHP-2 (Ab-580) Antibody

Sign In for Pricing
View Details
SHP-2 (Ab-580) Antibody
MBS856919-02 0.1 mg

SHP-2 (Ab-580) Antibody

Sign In for Pricing
View Details
SHP-2 (Ab-580) Antibody
MBS856919-03 0.1 mL (AF750)

SHP-2 (Ab-580) Antibody

Sign In for Pricing
View Details