Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gag Protein

This gag Protein spans the amino acid sequence from region 240-476aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0C776

Expression Region

240-476aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Avian leukosis virus RSA (RSV-SRA) (Rous sarcoma virus (strain Schmidt-Ruppin A) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLDRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADITQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRAAPSTLTTPGEIIKYVLDRQKIAPLTDQGIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem185b ORF Vector (Rat) (pORF)
ORF077884 1.0 µg DNA

Tmem185b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Cd300c2 (NM_134158) Mouse Tagged ORF Clone
MR202726 10 µg

Cd300c2 (NM_134158) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
EGFL6 Polyclonal Antibody, Biotin Conjugated
A58907-100 100 µL

EGFL6 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
EFCAB4B Protein Vector (Human) (pPM-C-HA)
18997021 500 ng

EFCAB4B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
EIF2S2 Blocking Peptide
33R-1911 100 ug

EIF2S2 Blocking Peptide

Sign In for Pricing
View Details
Cefodizime
C10830-25mg 25 mg

Cefodizime

Sign In for Pricing
View Details