Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf5 Protein

This Mouse Fgf5 Protein spans the amino acid sequence from region 21-264aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FGF-5) (Heparin-binding growth factor 5) (HBGF-5)

UniProt

P15656

Expression Region

21-264aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSPVAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVKPKVPLSQPRRSPSPVKYRLKFRFG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMSAP3 ORF Vector (Human) (pORF)
ORF016833 1.0 µg DNA

CAMSAP3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
N-Maleoyl-beta-alanine
BIM1007 1 g

N-Maleoyl-beta-alanine

Sign In for Pricing
View Details
BromoBlue Universal Loading Dye (6x)
10570005-2 25 mL

BromoBlue Universal Loading Dye (6x)

Sign In for Pricing
View Details
PDLIM3 ORF Vector (Human) (pORF)
ORF007653 1.0 µg DNA

PDLIM3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Escherichia coli O18:K1:H7 Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1122251-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O18:K1:H7 Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details
Recombinant Escherichia coli O18:K1:H7 Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)
MBS1122251-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O18:K1:H7 Peroxyureidoacrylate/ureidoacrylate amidohydrolase RutB (rutB)

Sign In for Pricing
View Details