Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Twist1 Protein

This Mouse Twist1 Protein spans the amino acid sequence from region 1-206aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(M-twist)

UniProt

P26687

Expression Region

1-206aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPAQGKRGKKSAGGGGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCC (SC9), mAb, Mouse
V08503-10 10 mg

SCC (SC9), mAb, Mouse

Sign In for Pricing
View Details
PMP2 discontinued
512923 100 µg

PMP2 discontinued

Sign In for Pricing
View Details
IFluor® 840 Anti-human CD32 Antibody *IV.3*
103200Q0-AAT 100 Tests

IFluor® 840 Anti-human CD32 Antibody *IV.3*

Sign In for Pricing
View Details
PE/iFluor® 594 Anti-human CD200 Antibody *OX-104*
120001Y2-AAT 500 Tests

PE/iFluor® 594 Anti-human CD200 Antibody *OX-104*

Sign In for Pricing
View Details
Zfp960 Protein Vector (Mouse) (pPM-C-His)
PV250617 500 ng

Zfp960 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
RRP9 Polyclonal Antibody
30086-01 50 µL

RRP9 Polyclonal Antibody

Sign In for Pricing
View Details