Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Twist1 Protein

This Mouse Twist1 Protein spans the amino acid sequence from region 1-206aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(M-twist)

UniProt

P26687

Expression Region

1-206aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MMQDVSSSPVSPADDSLSNSEEEPDRQQPASGKRGARKRRSSRRSAGGSAGPGGATGGGIGGGDEPGSPAQGKRGKKSAGGGGGGGAGGGGGGGGGSSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZGPAT Protein Vector (Mouse) (pPB-N-His)
PV250727 500 ng

ZGPAT Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Eapp Peptide - N-terminal region
MBS3238200-01 0.1 mg

Eapp Peptide - N-terminal region

Sign In for Pricing
View Details
Eapp Peptide - N-terminal region
MBS3238200-02 5x 0.1 mg

Eapp Peptide - N-terminal region

Sign In for Pricing
View Details
Rabbit Anti-GADD 45γ/GADD45G Polyclonal Antibody
PAV7444 100 μL

Rabbit Anti-GADD 45γ/GADD45G Polyclonal Antibody

Sign In for Pricing
View Details
SNCB Antibody
MBS8594431-01 0.1 mg

SNCB Antibody

Sign In for Pricing
View Details
SNCB Antibody
MBS8594431-02 0.1 mL (AF405L)

SNCB Antibody

Sign In for Pricing
View Details