Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGH Protein

This AGH Protein spans the amino acid sequence from region 22-65aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Pod-AGH)

UniProt

Q86SA8

Expression Region

22-65aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Porcellio dilatatus (Woodlouse)

Field of Research

Developmental Biology, Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YQVEGMKSDVICADIRFTVHCICNELGRFPTARLTKPCPWPNRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Vicugna pacos IL4 Polyclonal Antibody
ZY457014-01 50 µg

Anti-Vicugna pacos IL4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Vicugna pacos IL4 Polyclonal Antibody
ZY457014-02 100 µg

Anti-Vicugna pacos IL4 Polyclonal Antibody

Sign In for Pricing
View Details
Sheep 5-alpha reductase 2 (5AR2) ELISA Kit
YP-W79334-01 48 Tests

Sheep 5-alpha reductase 2 (5AR2) ELISA Kit

Sign In for Pricing
View Details
Sheep 5-alpha reductase 2 (5AR2) ELISA Kit
YP-W79334-02 96 Tests

Sheep 5-alpha reductase 2 (5AR2) ELISA Kit

Sign In for Pricing
View Details
TXNDC12 polyclonal antibody
orb648041-01 50 μL

TXNDC12 polyclonal antibody

Sign In for Pricing
View Details
TXNDC12 polyclonal antibody
orb648041-02 100 µL

TXNDC12 polyclonal antibody

Sign In for Pricing
View Details