Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine PF4 Protein

This Porcine PF4 Protein spans the amino acid sequence from region 1-90aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PF-4) (C-X-C motif chemokine 4)

UniProt

P30034

Expression Region

1-90aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEWSLPGTRVPPPADPEGGDANLRCVCVKTISGVSPKHISSLEVIGAGPHCPSPQLIATLKKGHKICLDPQNLLYKKIIKKLLKSQLLTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,6-Octanedione
TRC-O237500-1G 1 g

3,6-Octanedione

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS629091 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
UPP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G9]
TA812319AM 100 µL

UPP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G9]

Sign In for Pricing
View Details
CD26 Recombinant Rabbit monoclonal Antibody [JM11-42]
ET1703-93-50UL 50 µL

CD26 Recombinant Rabbit monoclonal Antibody [JM11-42]

Sign In for Pricing
View Details
GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF740 conjugate, 0.1mg/mL
BNC742982-100 1x 100 µL

GnRH-Receptor / LH-RH Receptor (GNRHR/2982R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF405S conjugate, 0.1mg/mL
BNC040362-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (RIV7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details