Neosartorya fumigata 60S acidic ribosomal protein P2 Protein
This Neosartorya fumigata 60S acidic ribosomal protein P2 Protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(AfP2) (allergen Asp f 8)
UniProt
Q9UUZ6
Expression Region
1-111aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Field of Research
Epigenetics
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MKHLAAYLLLALAGNTSPSSEDVKAVLSSVGIDADEERLNKLIAELEGKDLQELIAEGSTKLASVPSGGAAAAAPAAAGAAAGGAAAPAAEEKKEEEKEESDEDMGFGLFD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400460-500 1x 500 µL
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942266-500 1x 500 µL
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472266-500 1x 500 µL
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400375-100 1x 100 µL
P40 (Rabbit PAb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details