Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OmcA Protein

This omcA Protein spans the amino acid sequence from region 20-87aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Small-CRP) (9 kDa cysteine-rich lipoprotein) (9KD-CRP)

UniProt

P0CZ19

Expression Region

20-87aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Chlamydophila psittaci (Chlamydia psittaci)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CCRIVDCCFEDPCAPKPCNPCGNKKDKGCSPCGVYTPSCSKPCGSECNPGVQGPQAKGCTSLDGRCKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC1 Recombinant Protein (Human)
RP009559 100 µg

DNAJC1 Recombinant Protein (Human)

Sign In for Pricing
View Details
APOF Antibody (Center)
MBS9212310-01 0.08 mL

APOF Antibody (Center)

Sign In for Pricing
View Details
APOF Antibody (Center)
MBS9212310-02 0.4 mL

APOF Antibody (Center)

Sign In for Pricing
View Details
APOF Antibody (Center)
MBS9212310-03 5x 0.4 mL

APOF Antibody (Center)

Sign In for Pricing
View Details
Matrix metalloproteinase-9 MMP9 Rabbit Polyclonal Antibody (Fluoro647)
orb3083366 100 µg

Matrix metalloproteinase-9 MMP9 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
SDZ 21009
T23343-01 25 mg

SDZ 21009

Sign In for Pricing
View Details